PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71515.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 178aa    MW: 20057.4 Da    PI: 9.9353
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71515.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.8e-27959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krie+ks rq tf+kRrng+lKKA+ELSvLCd++v viifs++gk+y y++
  EPS71515.1  9 KRIEDKSARQATFTKRRNGLLKKAKELSVLCDVDVGVIIFSTRGKFYHYCN 59
                79***********************************************85 PP

2K-box22.93.5e-091181504577
       K-box  45 sLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                 +Lsl eL  Le+qLe +l +iR+ K  l+++ +
  EPS71515.1 118 QLSLTELVYLEKQLEAALMQIRAEKVTLIINTL 150
                 79************************9998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.338161IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-36160IPR002100Transcription factor, MADS-box
CDDcd002655.09E-33261No hitNo description
SuperFamilySSF554551.44E-28277IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-25323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGRKKLEIKR IEDKSARQAT FTKRRNGLLK KAKELSVLCD VDVGVIIFST RGKFYHYCNT  60
SRLSDILLQH RSHVENGDRT IGTDHSRVQN SKSPGAIKCS DLLDIVDKKF GKTCVEKQLS  120
LTELVYLEKQ LEAALMQIRA EKVTLIINTL AFSSLWSIIF RSFCAAAAAH CHPLNFCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18184183Myocyte-specific enhancer factor 2B
1tqe_Q1e-18184183Myocyte-specific enhancer factor 2B
1tqe_R1e-18184183Myocyte-specific enhancer factor 2B
1tqe_S1e-18184183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086821.14e-53PREDICTED: MADS-box transcription factor 7-like isoform X1
RefseqXP_011086823.13e-53PREDICTED: MADS-box transcription factor 7-like isoform X3
TrEMBLS8CX761e-130S8CX76_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.21e-31MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]